PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00596.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 126aa    MW: 14603.5 Da    PI: 9.0471
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00596.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.9e-09821152154
                              HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              k +yp++ ++  LA+ +gL+++q+ +WF N+R +
  Rsa1.0_00596.1_g00002.1  82 KWPYPTEGDKIALADATGLDQKQINNWFINQRKR 115
                              569*****************************88 PP

2ELK271e-093657122
                      ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                             +LK++LlrK+++ ++sLk EFs
  Rsa1.0_00596.1_g00002.1 36 DLKDRLLRKFGSGISSLKLEFS 57
                             69*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037895.6E-63657IPR005539ELK domain
SMARTSM011882.5E-43657IPR005539ELK domain
PROSITE profilePS512139.2023656IPR005539ELK domain
PROSITE profilePS5007112.17956119IPR001356Homeobox domain
SuperFamilySSF466895.56E-1957124IPR009057Homeodomain-like
SMARTSM003894.0E-1258123IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.8E-2761120IPR009057Homeodomain-like
CDDcd000861.65E-1065120No hitNo description
PfamPF059206.3E-1876115IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MTILRVPEDG AVSSDEELSG GDEILQDGKQ ICEDRDLKDR LLRKFGSGIS SLKLEFSKKK  60
KKGKLPREAR QALLDWWSVH YKWPYPTEGD KIALADATGL DQKQINNWFI NQRKRHWNQS  120
ENMPYA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009110101.11e-81PREDICTED: homeobox protein knotted-1-like 6
SwissprotQ84JS64e-69KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLM4DIM11e-81M4DIM1_BRARP; Uncharacterized protein
STRINGBra016348.1-P3e-81(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8352785
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.12e-62KNOTTED1-like homeobox gene 6